PDB entry 1px8

View 1px8 on RCSB PDB site
Description: Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase
Class: hydrolase
Keywords: family 39 glycoside hydrolase, xylosidase, xylan, xylose, covalent glycosyl-enzyme intermediate, HYDROLASE
Deposited on 2003-07-03, released 2003-12-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.224
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-xylosidase
    Species: Thermoanaerobacterium saccharolyticum [TaxId:28896]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36906 (0-499)
      • see remark 999 (229)
    Domains in SCOPe 2.07: d1px8a1, d1px8a2
  • Chain 'B':
    Compound: beta-xylosidase
    Species: Thermoanaerobacterium saccharolyticum [TaxId:28896]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36906 (0-499)
      • see remark 999 (229)
    Domains in SCOPe 2.07: d1px8b1, d1px8b2
  • Heterogens: XYP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1px8A (A:)
    mikvrvpdfsdkkfsdrwrycvgtgrlglalqkeyietlkyvkenidfkyirghgllcdd
    vgiyredvvgdevkpfynftyidrifdsfleigirpfveigfmpkklasgtqtvfywegn
    vtppkdyekwsdlvkavlhhfisrygieevlkwpfeiwnepnlkefwkdadekeyfklyk
    vtakaikevnenlkvggpaicggadywiedflnfcyeenvpvdfvsrhaytskqgeytph
    liyqeimpseymlnefktvreiiknshfpnlpfhiteyntsyspqnpvhdtpfnaayiar
    ilseggdyvdsfsywtfsdvfeerdvprsqfhggfglvalnmipkptfytfkffnamgee
    mlyrdehmlvtrrddgsvaliawnevmdktenpdedyeveipvrfrdvfikrqlideehg
    npwgtwihmgrprypskeqvntlrevakpeimtsqpvandgylnlkfklgknavvlyelt
    eridesstyiglddskingy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1px8B (B:)
    mikvrvpdfsdkkfsdrwrycvgtgrlglalqkeyietlkyvkenidfkyirghgllcdd
    vgiyredvvgdevkpfynftyidrifdsfleigirpfveigfmpkklasgtqtvfywegn
    vtppkdyekwsdlvkavlhhfisrygieevlkwpfeiwnepnlkefwkdadekeyfklyk
    vtakaikevnenlkvggpaicggadywiedflnfcyeenvpvdfvsrhaytskqgeytph
    liyqeimpseymlnefktvreiiknshfpnlpfhiteyntsyspqnpvhdtpfnaayiar
    ilseggdyvdsfsywtfsdvfeerdvprsqfhggfglvalnmipkptfytfkffnamgee
    mlyrdehmlvtrrddgsvaliawnevmdktenpdedyeveipvrfrdvfikrqlideehg
    npwgtwihmgrprypskeqvntlrevakpeimtsqpvandgylnlkfklgknavvlyelt
    eridesstyiglddskingy