PDB entry 1px6

View 1px6 on RCSB PDB site
Description: A folding mutant of human class pi glutathione transferase, created by mutating aspartate 153 of the wild-type protein to asparagine
Class: transferase
Keywords: glutathione transferase, helix capping, mutations, protein folding, X-ray crystallography
Deposited on 2003-07-02, released 2003-07-22
The last revision prior to the SCOP 1.73 freeze date was dated 2003-07-22, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.19
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutathione S-transferase P
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09211 (0-208)
      • engineered (151)
    Domains in SCOP 1.73: d1px6a1, d1px6a2
  • Chain 'B':
    Compound: Glutathione S-transferase P
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09211 (0-208)
      • engineered (151)
    Domains in SCOP 1.73: d1px6b1, d1px6b2
  • Heterogens: MES, GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1px6A (A:)
    ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
    tlyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvk
    alpgqlkpfetllsqnqggktfivgdqisfanynlldlllihevlapgcldafpllsayv
    grlsarpklkaflaspeyvnlpingngkq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1px6B (B:)
    ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
    tlyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvk
    alpgqlkpfetllsqnqggktfivgdqisfanynlldlllihevlapgcldafpllsayv
    grlsarpklkaflaspeyvnlpingngkq