PDB entry 1px5

View 1px5 on RCSB PDB site
Description: Crystal structure of the 2'-specific and double-stranded RNA-activated interferon-induced antiviral protein 2'-5'-oligoadenylate synthetase
Class: transferase
Keywords: 5-stranded antiparalel beta sheet, four helix bundle, TRANSFERASE
Deposited on 2003-07-02, released 2003-11-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: 0.187
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2'-5'-oligoadenylate synthetase 1
    Species: Sus scrofa [TaxId:9823]
    Gene: OAS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q29599 (0-End)
      • modified residue (23)
      • modified residue (36)
    Domains in SCOPe 2.08: d1px5a1, d1px5a2
  • Chain 'B':
    Compound: 2'-5'-oligoadenylate synthetase 1
    Species: Sus scrofa [TaxId:9823]
    Gene: OAS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q29599 (0-348)
      • modified residue (23)
      • modified residue (36)
    Domains in SCOPe 2.08: d1px5b1, d1px5b2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1px5A (A:)
    melrhtpardldkfiedhllpntcfrtqvkeaidivcrflkercfqgtadpvrvskvvkg
    gssgkgttlrgrsdadlvvfltkltsfedqlrrrgefiqeirrqleacqreqkfkvtfev
    qsprrenpralsfvlsspqlqqevefdvlpafdalgqwtpgykpnpeiyvqlikecksrg
    kegefstcftelqrdflrnrptklkslirlvkhwyqtckkthgnklppqyalelltvyaw
    eqgsrktdfstaqgfqtvlelvlkhqklcifweayydftnpvvgrcmlqqlkkprpvild
    padptgnvgggdthswqrlaqearvwlgypccknldgslvgawtmlqki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1px5A (A:)
    melrhtpardldkfiedhllpntcfrtqvkeaidivcrflkercfqgpvrvskvvkggss
    rsdadlvvfltkltsfedqlrrrgefiqeirrqleacqreqkfkvtfevqspalsfvlss
    pqlqqevefdvlpafdalgqwtpgykpnpeiyvqlikecksrgkegefstcftelqrdfl
    rnrptklkslirlvkhwyqtckkthgnklppqyalelltvyaweqgsrktdfstaqgfqt
    vlelvlkhqklcifweayydftnpvvgrcmlqqlkkprpvildpadptgnvgggdthswq
    rlaqearvwlgypccknldgslvgawtml
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1px5B (B:)
    melrhtpardldkfiedhllpntcfrtqvkeaidivcrflkercfqgtadpvrvskvvkg
    gssgkgttlrgrsdadlvvfltkltsfedqlrrrgefiqeirrqleacqreqkfkvtfev
    qsprrenpralsfvlsspqlqqevefdvlpafdalgqwtpgykpnpeiyvqlikecksrg
    kegefstcftelqrdflrnrptklkslirlvkhwyqtckkthgnklppqyalelltvyaw
    eqgsrktdfstaqgfqtvlelvlkhqklcifweayydftnpvvgrcmlqqlkkprpvild
    padptgnvgggdthswqrlaqearvwlgypccknldgslvgawtmlqki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1px5B (B:)
    melrhtpardldkfiedhllpntcfrtqvkeaidivcrflkercfqgtadpvrvskvvkg
    gssgkgrgrsdadlvvfltkltsfedqlrrrgefiqeirrqleacqreqkfkvtfevqsp
    ralsfvlsspqlqqevefdvlpafdalgqwtpgykpnpeiyvqlikecksrgkegefstc
    ftelqrdflrnrptklkslirlvkhwyqtckkthgnklppqyalelltvyaweqgsrktd
    fstaqgfqtvlelvlkhqklcifweayydftnpvvgrcmlqqlkkprpvildpadptgnv
    gggdthswqrlaqearvwlgypccknldgslvgawtmlqki