PDB entry 1pwy

View 1pwy on RCSB PDB site
Description: crystal structure of human pnp complexed with acyclovir
Class: transferase
Keywords: purine nucleoside phosphorylase, drug design, synchrotron, acyclovir, transferase
Deposited on 2003-07-02, released 2004-03-23
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.215
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: purine nucleoside phosphorylase
    Species: Homo sapiens [TaxId:9606]
    Gene: PNP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1pwye_
  • Heterogens: SO4, AC2, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pwyE (E:)
    engytyedykntaewllshtkhrpqvaiicgsglggltdkltqaqifdyseipnfprstv
    pghagrlvfgflngracvmmqgrfhmyegyplwkvtfpvrvfhllgvdtlvvtnaaggln
    pkfevgdimlirdhinlpgfsgqnplrgpnderfgdrfpamsdaydrtmrqralstwkqm
    geqrelqegtyvmvagpsfetvaecrvlqklgadavgmstvpevivarhcglrvfgfsli
    tnkvimdyeslekanheevlaagkqaaqkleqfvsilmasiplpdkas