PDB entry 1pwt

View 1pwt on RCSB PDB site
Description: thermodynamic analysis of alpha-spectrin sh3 and two of its circular permutants with different loop lengths: discerning the reasons for rapid folding in proteins
Deposited on 1998-10-06, released 1999-05-11
The last revision prior to the SCOP 1.71 freeze date was dated 1999-05-11, with a file datestamp of 1999-05-10.
Experiment type: XRAY+
Resolution: 1.77 Å
R-factor: 0.189
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1pwt__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pwt_ (-)
    mgtgkelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevndrqgfvpaayvkkl
    d