PDB entry 1pwk

View 1pwk on RCSB PDB site
Description: structure of the monomeric 8-kda dynein light chain and mechanism of domain swapped dimer assembly
Deposited on 2003-07-02, released 2003-10-21
The last revision prior to the SCOP 1.67 freeze date was dated 2003-10-21, with a file datestamp of 2003-10-21.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.67: d1pwka_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pwkA (A:)
  msdrkaviknadmsedmqqdavdcatqamekyniekdiaayikkefdkkynptwhcivgr
  sgnfgsyvthetkhfiyfylgqvaillfksg