PDB entry 1pwj

View 1pwj on RCSB PDB site
Description: Structure of the Monomeric 8-kDa Dynein Light Chain and Mechanism of Domain Swapped Dimer Assembly
Class: contractile protein
Keywords: Dynein, Dynein Light Chain, Dimer-monomer Equilibrium, Domain swapping
Deposited on 2003-07-02, released 2003-10-21
The last revision prior to the SCOP 1.75 freeze date was dated 2003-10-21, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: dynein light chain-2
  Species: Rattus norvegicus
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9D0M5 (0-88)
  Domains in SCOP 1.75: d1pwja_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pwjA (A:)
  msdrkaviknadmsedmqqdavdcatqamekyniekdiaayikkefdkkynptwhcivgr
  nfgsyvthetkhfiyfylgqvaillfksg