PDB entry 1pwh

View 1pwh on RCSB PDB site
Description: Rat Liver L-Serine Dehydratase- Complex with PYRIDOXYL-(O-METHYL-SERINE)-5-MONOPHOSPHATE
Class: lyase
Keywords: Rat Liver, L-Serine Dehydratase, Complex, LYASE
Deposited on 2003-07-01, released 2003-12-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-serine dehydratase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pwha_
  • Chain 'B':
    Compound: L-serine dehydratase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pwhb_
  • Chain 'C':
    Compound: L-serine dehydratase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pwhc_
  • Chain 'D':
    Compound: L-serine dehydratase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pwhd_
  • Heterogens: K, PLV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pwhA (A:)
    maaqeslhvktplrdsmalskvagtsvflkmdssqpsgsfkirgighlckmkakqgckhf
    vcssagnagmatayaarrlglpativvpsttpaltierlknegatvevvgemldeaiqla
    kaleknnpgwvyispfddpliweghtslvkelketlsakpgaivlsvggggllcgvvqgl
    revgwedvpiiametfgahsfhaavkegklvtlpkitsvakalgvntvgaqtlklfyehp
    ifsevisdqeavtaiekfvddekilvepacgaalaavysgvvcrlqaearlqtplaslvv
    ivcggsnislaqlqalkaqlglnellk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pwhB (B:)
    maaqeslhvktplrdsmalskvagtsvflkmdssqpsgsfkirgighlckmkakqgckhf
    vcssagnagmatayaarrlglpativvpsttpaltierlknegatvevvgemldeaiqla
    kaleknnpgwvyispfddpliweghtslvkelketlsakpgaivlsvggggllcgvvqgl
    revgwedvpiiametfgahsfhaavkegklvtlpkitsvakalgvntvgaqtlklfyehp
    ifsevisdqeavtaiekfvddekilvepacgaalaavysgvvcrlqaearlqtplaslvv
    ivcggsnislaqlqalkaqlglnellk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pwhC (C:)
    maaqeslhvktplrdsmalskvagtsvflkmdssqpsgsfkirgighlckmkakqgckhf
    vcssagnagmatayaarrlglpativvpsttpaltierlknegatvevvgemldeaiqla
    kaleknnpgwvyispfddpliweghtslvkelketlsakpgaivlsvggggllcgvvqgl
    revgwedvpiiametfgahsfhaavkegklvtlpkitsvakalgvntvgaqtlklfyehp
    ifsevisdqeavtaiekfvddekilvepacgaalaavysgvvcrlqaearlqtplaslvv
    ivcggsnislaqlqalkaqlglnellk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pwhD (D:)
    maaqeslhvktplrdsmalskvagtsvflkmdssqpsgsfkirgighlckmkakqgckhf
    vcssagnagmatayaarrlglpativvpsttpaltierlknegatvevvgemldeaiqla
    kaleknnpgwvyispfddpliweghtslvkelketlsakpgaivlsvggggllcgvvqgl
    revgwedvpiiametfgahsfhaavkegklvtlpkitsvakalgvntvgaqtlklfyehp
    ifsevisdqeavtaiekfvddekilvepacgaalaavysgvvcrlqaearlqtplaslvv
    ivcggsnislaqlqalkaqlglnellk