PDB entry 1pwg

View 1pwg on RCSB PDB site
Description: Covalent Penicilloyl Acyl Enzyme Complex Of The Streptomyces R61 DD-Peptidase With A Highly Specific Penicillin
Class: hydrolase/antibiotic
Keywords: BETA-LACTAM, PENICILLIN BINDING PROTEIN, ENZYME, PEPTIDOGLYCAN, HYDROLASE-ANTIBIOTIC complex
Deposited on 2003-07-01, released 2004-07-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-03-07, with a file datestamp of 2012-03-02.
Experiment type: XRAY
Resolution: 1.07 Å
R-factor: 0.106
AEROSPACI score: 1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-alanyl-d-alanine carboxypeptidase
    Species: Streptomyces sp. [TaxId:31952]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pwga_
  • Heterogens: HE0, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pwgA (A:)
    adlpapddtglqavlhtalsqgapgamvrvddngtihqlsegvadratgraitttdrfrv
    gsvtksfsavvllqlvdegkldldasvntylpgllpddritvrqvmshrsglydytndmf
    aqtvpgfesvrnkvfsyqdlitlslkhgvtnapgaaysysntnfvvagmliekltghsva
    teyqnriftplnltdtfyvhpdtvipgthangyltpdeaggalvdsteqtvswaqsagav
    isstqdldtffsalmsgqlmsaaqlaqmqqwttvnstqgyglglrrrdlscgisvyghtg
    tvqgyytyafaskdgkrsvtalantsnnvnvlntmartlesafcgkptt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pwgA (A:)
    lpapddtglqavlhtalsqgapgamvrvddngtihqlsegvadratgraitttdrfrvgs
    vtksfsavvllqlvdegkldldasvntylpgllpddritvrqvmshrsglydytndmfaq
    tvpgfesvrnkvfsyqdlitlslkhgvtnapgaaysysntnfvvagmliekltghsvate
    yqnriftplnltdtfyvhpdtvipgthangyltpdeaggalvdsteqtvswaqsagavis
    stqdldtffsalmsgqlmsaaqlaqmqqwttvnstqgyglglrrrdlscgisvyghtgtv
    qgyytyafaskdgkrsvtalantsnnvnvlntmartlesafcgkp