PDB entry 1pwe

View 1pwe on RCSB PDB site
Description: Rat Liver L-Serine Dehydratase Apo Enzyme
Class: lyase
Keywords: rat liver, l-serine dehydratase, apo enzyme, lyase
Deposited on 2003-07-01, released 2003-12-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.218
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-serine dehydratase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pwea_
  • Chain 'B':
    Compound: L-serine dehydratase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pweb_
  • Chain 'C':
    Compound: L-serine dehydratase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pwec_
  • Chain 'D':
    Compound: L-serine dehydratase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pwed_
  • Chain 'E':
    Compound: L-serine dehydratase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pwee_
  • Chain 'F':
    Compound: L-serine dehydratase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pwef_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pweA (A:)
    maaqeslhvktplrdsmalskvagtsvflkmdssqpsgsfkirgighlckmkakqgckhf
    vcssagnagmatayaarrlglpativvpsttpaltierlknegatvevvgemldeaiqla
    kaleknnpgwvyispfddpliweghtslvkelketlsakpgaivlsvggggllcgvvqgl
    revgwedvpiiametfgahsfhaavkegklvtlpkitsvakalgvntvgaqtlklfyehp
    ifsevisdqeavtaiekfvddekilvepacgaalaavysgvvcrlqaearlqtplaslvv
    ivcggsnislaqlqalkaqlglnellk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pweA (A:)
    slhvktplrdsmalskvagtsvflkmdssqpsgsfkirgighlckmkakqgckhfvcssa
    gnagmatayaarrlglpativvpsttpaltierlknegatvevvgemldeaiqlakalek
    nnpgwvyispfddpliweghtslvkelketlsakpgaivlsvggggllcgvvqglrevgw
    edvpiiametfgahsfhaavkegklvtlpkitsvakalgvntvgaqtlklfyehpifsev
    isdqeavtaiekfvddekilvepacgaalaavysgvvcrlqaearlqtplaslvvivcgg
    snislaqlqalkaql
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pweB (B:)
    maaqeslhvktplrdsmalskvagtsvflkmdssqpsgsfkirgighlckmkakqgckhf
    vcssagnagmatayaarrlglpativvpsttpaltierlknegatvevvgemldeaiqla
    kaleknnpgwvyispfddpliweghtslvkelketlsakpgaivlsvggggllcgvvqgl
    revgwedvpiiametfgahsfhaavkegklvtlpkitsvakalgvntvgaqtlklfyehp
    ifsevisdqeavtaiekfvddekilvepacgaalaavysgvvcrlqaearlqtplaslvv
    ivcggsnislaqlqalkaqlglnellk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pweB (B:)
    slhvktplrdsmalskvagtsvflkmdssqpsgsfkirgighlckmkakqgckhfvcssa
    gnagmatayaarrlglpativvpsttpaltierlknegatvevvgemldeaiqlakalek
    nnpgwvyispfddpliweghtslvkelketlsakpgaivlsvggggllcgvvqglrevgw
    edvpiiametfgahsfhaavkegklvtlpkitsvakalgvntvgaqtlklfyehpifsev
    isdqeavtaiekfvddekilvepacgaalaavysgvvcrlqaearlqtplaslvvivcgg
    snislaqlqalkaql
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1pweC (C:)
    maaqeslhvktplrdsmalskvagtsvflkmdssqpsgsfkirgighlckmkakqgckhf
    vcssagnagmatayaarrlglpativvpsttpaltierlknegatvevvgemldeaiqla
    kaleknnpgwvyispfddpliweghtslvkelketlsakpgaivlsvggggllcgvvqgl
    revgwedvpiiametfgahsfhaavkegklvtlpkitsvakalgvntvgaqtlklfyehp
    ifsevisdqeavtaiekfvddekilvepacgaalaavysgvvcrlqaearlqtplaslvv
    ivcggsnislaqlqalkaqlglnellk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pweC (C:)
    slhvktplrdsmalskvagtsvflkmdssqpsgsfkirgighlckmkakqgckhfvcssa
    gnagmatayaarrlglpativvpsttpaltierlknegatvevvgemldeaiqlakalek
    nnpgwvyispfddpliweghtslvkelketlsakpgaivlsvggggllcgvvqglrevgw
    edvpiiametfgahsfhaavkegklvtlpkitsvakalgvntvgaqtlklfyehpifsev
    isdqeavtaiekfvddekilvepacgaalaavysgvvcrlqaearlqtplaslvvivcgg
    snislaqlqalkaql
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1pweD (D:)
    maaqeslhvktplrdsmalskvagtsvflkmdssqpsgsfkirgighlckmkakqgckhf
    vcssagnagmatayaarrlglpativvpsttpaltierlknegatvevvgemldeaiqla
    kaleknnpgwvyispfddpliweghtslvkelketlsakpgaivlsvggggllcgvvqgl
    revgwedvpiiametfgahsfhaavkegklvtlpkitsvakalgvntvgaqtlklfyehp
    ifsevisdqeavtaiekfvddekilvepacgaalaavysgvvcrlqaearlqtplaslvv
    ivcggsnislaqlqalkaqlglnellk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pweD (D:)
    slhvktplrdsmalskvagtsvflkmdssqpsgsfkirgighlckmkakqgckhfvcssa
    gnagmatayaarrlglpativvpsttpaltierlknegatvevvgemldeaiqlakalek
    nnpgwvyispfddpliweghtslvkelketlsakpgaivlsvggggllcgvvqglrevgw
    edvpiiametfgahsfhaavkegklvtlpkitsvakalgvntvgaqtlklfyehpifsev
    isdqeavtaiekfvddekilvepacgaalaavysgvvcrlqaearlqtplaslvvivcgg
    snislaqlqalkaql
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1pweE (E:)
    maaqeslhvktplrdsmalskvagtsvflkmdssqpsgsfkirgighlckmkakqgckhf
    vcssagnagmatayaarrlglpativvpsttpaltierlknegatvevvgemldeaiqla
    kaleknnpgwvyispfddpliweghtslvkelketlsakpgaivlsvggggllcgvvqgl
    revgwedvpiiametfgahsfhaavkegklvtlpkitsvakalgvntvgaqtlklfyehp
    ifsevisdqeavtaiekfvddekilvepacgaalaavysgvvcrlqaearlqtplaslvv
    ivcggsnislaqlqalkaqlglnellk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pweE (E:)
    slhvktplrdsmalskvagtsvflkmdssqpsgsfkirgighlckmkakqgckhfvcssa
    gnagmatayaarrlglpativvpsttpaltierlknegatvevvgemldeaiqlakalek
    nnpgwvyispfddpliweghtslvkelketlsakpgaivlsvggggllcgvvqglrevgw
    edvpiiametfgahsfhaavkegklvtlpkitsvakalgvntvgaqtlklfyehpifsev
    isdqeavtaiekfvddekilvepacgaalaavysgvvcrlqaearlqtplaslvvivcgg
    snislaqlqalkaql
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1pweF (F:)
    maaqeslhvktplrdsmalskvagtsvflkmdssqpsgsfkirgighlckmkakqgckhf
    vcssagnagmatayaarrlglpativvpsttpaltierlknegatvevvgemldeaiqla
    kaleknnpgwvyispfddpliweghtslvkelketlsakpgaivlsvggggllcgvvqgl
    revgwedvpiiametfgahsfhaavkegklvtlpkitsvakalgvntvgaqtlklfyehp
    ifsevisdqeavtaiekfvddekilvepacgaalaavysgvvcrlqaearlqtplaslvv
    ivcggsnislaqlqalkaqlglnellk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pweF (F:)
    slhvktplrdsmalskvagtsvflkmdssqpsgsfkirgighlckmkakqgckhfvcssa
    gnagmatayaarrlglpativvpsttpaltierlknegatvevvgemldeaiqlakalek
    nnpgwvyispfddpliweghtslvkelketlsakpgaivlsvggggllcgvvqglrevgw
    edvpiiametfgahsfhaavkegklvtlpkitsvakalgvntvgaqtlklfyehpifsev
    isdqeavtaiekfvddekilvepacgaalaavysgvvcrlqaearlqtplaslvvivcgg
    snislaqlqalkaql