PDB entry 1pwb

View 1pwb on RCSB PDB site
Description: high resolution crystal structure of an active recombinant fragment of human lung surfactant protein d with maltose
Deposited on 2003-07-01, released 2003-08-05
The last revision prior to the SCOP 1.67 freeze date was dated 2003-08-05, with a file datestamp of 2003-08-05.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.205
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pwbA (A:)
    gspglkgdkgipgdkgakgesglpdvaslrqqvealqgqvqhlqaafsqykkvelfpngq
    svgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaaflsmtds
    ktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvcef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pwbA (A:)
    aslrqqvealqgqvqhlqaafsqykkvelfpngqsvgekifktagfvkpfteaqllctqa
    ggqlasprsaaenaalqqlvvakneaaflsmtdsktegkftyptgeslvysnwapgepnd
    dggsedcveiftngkwndracgekrlvvcef
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pwbB (B:)
    gspglkgdkgipgdkgakgesglpdvaslrqqvealqgqvqhlqaafsqykkvelfpngq
    svgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaaflsmtds
    ktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvcef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pwbB (B:)
    aslrqqvealqgqvqhlqaafsqykkvelfpngqsvgekifktagfvkpfteaqllctqa
    ggqlasprsaaenaalqqlvvakneaaflsmtdsktegkftyptgeslvysnwapgepnd
    dggsedcveiftngkwndracgekrlvvcef
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1pwbC (C:)
    gspglkgdkgipgdkgakgesglpdvaslrqqvealqgqvqhlqaafsqykkvelfpngq
    svgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaaflsmtds
    ktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvcef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pwbC (C:)
    slrqqvealqgqvqhlqaafsqykkvelfpngqsvgekifktagfvkpfteaqllctqag
    gqlasprsaaenaalqqlvvakneaaflsmtdsktegkftyptgeslvysnwapgepndd
    ggsedcveiftngkwndracgekrlvvcef