PDB entry 1pwa

View 1pwa on RCSB PDB site
Description: Crystal structure of Fibroblast Growth Factor 19
Class: hormone/growth factor
Keywords: beta trefoil, disulphide bonds, hormone-growth factor complex
Deposited on 2003-07-01, released 2004-01-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-16, with a file datestamp of 2014-04-11.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.181
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fibroblast growth factor-19
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pwaa_
  • Heterogens: SO4, TRS, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pwaA (A:)
    gsmsgdpirlrhlytsgphglsscflriradgvvdcargqsahslleikavalrtvaikg
    vhsvrylcmgadgkmqgllqyseedcafeeeirpdgynvyrsekhrlpvslssakqrqly
    knrgflplshflpmlpmvpeepedlrghlesdmfsspletds
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pwaA (A:)
    pirlrhlytsgphglsscflriradgvvdcargqsahslleikavalrtvaikgvhsvry
    lcmgadgkmqgllqyseedcafeeeirpdgynvyrsekhrlpvslslplshflpmlpmvp
    eep