PDB entry 1pw4

View 1pw4 on RCSB PDB site
Description: Crystal Structure of the Glycerol-3-Phosphate Transporter from E.Coli
Class: membrane protein
Keywords: Glycerol-3-Phosphate, Transmembrane, Inner membrane, Transporter, Major facilitator superfamily, Secondary active membrane transporter, MEMBRANE PROTEIN
Deposited on 2003-06-30, released 2003-08-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.296
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycerol-3-phosphate transporter
    Species: Escherichia coli [TaxId:562]
    Gene: glpT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08194 (Start-446)
      • cloning artifact (447-449)
    Domains in SCOPe 2.07: d1pw4a1, d1pw4a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pw4A (A:)
    gsifkpaphkarlpaaeidptyrrlrwqiflgiffgyaayylvrknfalampylveqgfs
    rgdlgfalsgisiaygfskfimgsvsdrsnprvflpaglilaaavmlfmgfvpwatssia
    vmfvllflcgwfqgmgwppcgrtmvhwwsqkerggivsvwncahnvgggippllfllgma
    wfndwhaalympafcailvalfafammrdtpqscglppieeykndypddynekaeqelta
    kqifmqyvlpnkllwyiaianvfvyllrygildwsptylkevkhfaldksswayflyeya
    gipgtllcgwmsdkvfrgnrgatgvffmtlvtiativywmnpagnptvdmicmivigfli
    ygpvmliglhalelapkkaagtaagftglfgylggsvaasaivgytvdffgwdggfmvmi
    ggsilavillivvmigekrrheqllqelvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pw4A (A:)
    fkpaphkarlpaaeidptyrrlrwqiflgiffgyaayylvrknfalampylveqgfsrgd
    lgfalsgisiaygfskfimgsvsdrsnprvflpaglilaaavmlfmgfvpwatssiavmf
    vllflcgwfqgmgwppcgrtmvhwwsqkerggivsvwncahnvgggippllfllgmawfn
    dwhaalympafcailvalfafammrdtpqscglppieeykndtakqifmqyvlpnkllwy
    iaianvfvyllrygildwsptylkevkhfaldksswayflyeyagipgtllcgwmsdkvf
    rgnrgatgvffmtlvtiativywmnpagnptvdmicmivigfliygpvmliglhalelap
    kkaagtaagftglfgylggsvaasaivgytvdffgwdggfmvmiggsilavillivvmig
    ekrrheqllqelvp