PDB entry 1pw3
View 1pw3 on RCSB PDB site
Description: Crystal structure of JtoR68S
Class: immune system
Keywords: Light Chain, amyloidosis, IMMUNE SYSTEM
Deposited on
2003-06-30, released
2004-08-17
The last revision prior to the SCOPe 2.04 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.22
AEROSPACI score: 0.45
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: immunoglobulin lambda chain variable region
Species: Homo sapiens [TaxId:9606]
Gene: Jto
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d1pw3a_ - Chain 'B':
Compound: immunoglobulin lambda chain variable region
Species: Homo sapiens [TaxId:9606]
Gene: Jto
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d1pw3b_ - Heterogens: CD, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1pw3A (A:)
nfmlnqphsvsespgktvtisctrssgnidsnyvqwyqqrpgsapitviyednqrpsgvp
drfagsidsssnsasltisglktedeadyycqsydarnvvfgggtrltvlg
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1pw3B (B:)
nfmlnqphsvsespgktvtisctrssgnidsnyvqwyqqrpgsapitviyednqrpsgvp
drfagsidsssnsasltisglktedeadyycqsydarnvvfgggtrltvlg