PDB entry 1pvy

View 1pvy on RCSB PDB site
Description: 3,4-dihydroxy-2-butanone 4-phosphate synthase from M. jannaschii in complex with ribulose 5-phosphate
Class: isomerase
Keywords: riboflavin biosynthesis, ISOMERASE
Deposited on 2003-06-29, released 2003-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.213
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3,4-dihydroxy-2-butanone 4-phosphate synthase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ0055
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q60364
      • engineered (146)
    Domains in SCOPe 2.07: d1pvya_
  • Chain 'B':
    Compound: 3,4-dihydroxy-2-butanone 4-phosphate synthase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ0055
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q60364
      • engineered (146)
    Domains in SCOPe 2.07: d1pvyb_
  • Heterogens: 5RP, ZN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pvyA (A:)
    mnnvekaiealkkgeiilvydsderegetdmvvasqfitpehirimrkdagglictalhp
    dicnklgipfmvdilefasqkfkvlrelypndipydekssfsitinhrktftgitdndra
    ftikklaelvkegrfndfgkefrspgsvtllraaeglvknrqghtemtvalaelanlvpi
    tticemmgddgnamsknetkryaekhnliylsgeeiinyyldkylkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pvyA (A:)
    nnvekaiealkkgeiilvydsderegetdmvvasqfitpehirimrkdagglictalhpd
    icnklgipfmvdilefasqkfkvlrelypndipydekssfsitinhrktftgitdndraf
    tikklaelvkegrfndfgkefrspgsvtllraaeglvknrqghtemtvalaelanlvpit
    ticemmgddgnamsknetkryaekhnliylsgeeiinyy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pvyB (B:)
    mnnvekaiealkkgeiilvydsderegetdmvvasqfitpehirimrkdagglictalhp
    dicnklgipfmvdilefasqkfkvlrelypndipydekssfsitinhrktftgitdndra
    ftikklaelvkegrfndfgkefrspgsvtllraaeglvknrqghtemtvalaelanlvpi
    tticemmgddgnamsknetkryaekhnliylsgeeiinyyldkylkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pvyB (B:)
    nvekaiealkkgeiilvydsderegetdmvvasqfitpehirimrkdagglictalhpdi
    cnklgipfmvdilefasqkfkvlrelypndipydekssfsitinhrktftgitdndraft
    ikklaelvkegrfndfgkefrspgsvtllraaeglvknrqghtemtvalaelanlvpitt
    icemmgddgnamsknetkryaekhnliylsgeeiinyyl