PDB entry 1pvu

View 1pvu on RCSB PDB site
Description: the crystal structure of pvuii endonuclease reveals extensive structural homologies to ecorv
Deposited on 1995-03-09, released 1995-03-31
The last revision prior to the SCOP 1.55 freeze date was dated 1995-03-31, with a file datestamp of 1995-03-26.
Experiment type: -
Resolution: 2.4 Å
R-factor: 0.184
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1pvua_
  • Chain 'B':
    Domains in SCOP 1.55: d1pvub_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pvuA (A:)
    shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpggndavdna
    gqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdlefy
    ydkwerkwysdghkdinnpkipvkyvmehgtkiy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pvuB (B:)
    shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpggndavdna
    gqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdlefy
    ydkwerkwysdghkdinnpkipvkyvmehgtkiy