PDB entry 1pvt

View 1pvt on RCSB PDB site
Description: Crystal structure of sugar-phosphate aldolase from Thermotoga maritima
Class: lyase
Keywords: Structural genomics, sugar-phosphate aldolase, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, LYASE
Deposited on 2003-06-28, released 2003-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.257
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sugar-phosphate aldolase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM1072
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0G1 (2-End)
      • cloning artifact (3)
      • cloning artifact (2)
      • modified residue (2)
      • modified residue (57)
      • modified residue (68)
      • modified residue (107)
      • modified residue (115)
      • modified residue (134)
      • modified residue (146-147)
    Domains in SCOPe 2.07: d1pvta_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pvtA (A:)
    ghmretireiqkvaywlaikglseanagnisvrlderpegyevksvneygfdydgpemyl
    litatgsrmrevyeddskicllhvlpgkhyeilhgngkptsefpthlmihakfkemnpek
    kaivhthplnlltlmnleefqellpkmmkihpevliffpqgisvvefekpgsvelglktv
    eksegkdavlwdkhgvvafgkdvaeaydrveilekaaeillrvlslgrnptgvpegwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pvtA (A:)
    ghmretireiqkvaywlaikglseanagnisvrlderpegyevksvneygfdydgpemyl
    litatgsrmrevyeddskicllhvlpgkhyeilhgngkptsefpthlmihakfkemnpek
    kaivhthplnlltlmnleefqellpkmmkihpevliffpqgisvvefekpgsvelglktv
    eksegkdavlwdkhgvvafgkdvaeaydrveilekaaeillrvlslgrnptg