PDB entry 1pvs

View 1pvs on RCSB PDB site
Description: 3-methyladenine Glcosylase II(AlkA) Hypoxanthine complex
Deposited on 2003-06-28, released 2004-06-08
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-08, with a file datestamp of 2004-06-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.232
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pvsA (A:)
    mytlnwqppydwswmlgflaaravssvetvadsyyarslavgeyrgvvtaipdiarhtlh
    inlsaglepvaaeclakmsrlfdlqcnpqivngalgrlgaarpglrlpgcvdafeqgvra
    ilgqlvsvamaakltarvaqlygerlddfpeyicfptpqrlaaadpqalkalgmplkrae
    alihlanaalegtlpmtipgdveqamktlqtfpgigrwtanyfalrgwqakdvflpddyl
    ikqrfpgmtpaqirryaerwkpwrsyallhiwytegwqpdea
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pvsB (B:)
    mytlnwqppydwswmlgflaaravssvetvadsyyarslavgeyrgvvtaipdiarhtlh
    inlsaglepvaaeclakmsrlfdlqcnpqivngalgrlgaarpglrlpgcvdafeqgvra
    ilgqlvsvamaakltarvaqlygerlddfpeyicfptpqrlaaadpqalkalgmplkrae
    alihlanaalegtlpmtipgdveqamktlqtfpgigrwtanyfalrgwqakdvflpddyl
    ikqrfpgmtpaqirryaerwkpwrsyallhiwytegwqpdea