PDB entry 1pvs

View 1pvs on RCSB PDB site
Description: 3-methyladenine Glcosylase II(AlkA) Hypoxanthine complex
Class: hydrolase
Keywords: AlkA, hypoxanthine, DNA glycosylase, DNA repair, reaction-product complex, HYDROLASE
Deposited on 2003-06-28, released 2004-06-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.232
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-3-methyladenine glycosylase II
    Species: Escherichia coli [TaxId:562]
    Gene: ALKA OR AIDA OR B2068
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pvsa1, d1pvsa2
  • Chain 'B':
    Compound: DNA-3-methyladenine glycosylase II
    Species: Escherichia coli [TaxId:562]
    Gene: ALKA OR AIDA OR B2068
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pvsb1, d1pvsb2
  • Heterogens: 7HP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pvsA (A:)
    mytlnwqppydwswmlgflaaravssvetvadsyyarslavgeyrgvvtaipdiarhtlh
    inlsaglepvaaeclakmsrlfdlqcnpqivngalgrlgaarpglrlpgcvdafeqgvra
    ilgqlvsvamaakltarvaqlygerlddfpeyicfptpqrlaaadpqalkalgmplkrae
    alihlanaalegtlpmtipgdveqamktlqtfpgigrwtanyfalrgwqakdvflpddyl
    ikqrfpgmtpaqirryaerwkpwrsyallhiwytegwqpdea
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pvsB (B:)
    mytlnwqppydwswmlgflaaravssvetvadsyyarslavgeyrgvvtaipdiarhtlh
    inlsaglepvaaeclakmsrlfdlqcnpqivngalgrlgaarpglrlpgcvdafeqgvra
    ilgqlvsvamaakltarvaqlygerlddfpeyicfptpqrlaaadpqalkalgmplkrae
    alihlanaalegtlpmtipgdveqamktlqtfpgigrwtanyfalrgwqakdvflpddyl
    ikqrfpgmtpaqirryaerwkpwrsyallhiwytegwqpdea