PDB entry 1pvo

View 1pvo on RCSB PDB site
Description:
Deposited on 2003-06-27, released 2003-07-22
The last revision prior to the SCOP 1.71 freeze date was dated 2003-07-22, with a file datestamp of 2003-07-22.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.274
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pvoA (A:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpenarnkilfenltplhansrlrmergngstedltarvldlaspigrgqrglivapp
    kagktmllqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhv
    qvaemviekakrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrpkrf
    fgaarnveeggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidy
    nrsgtrkeellttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmkrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pvoA (A:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpennkilfenltplhansrlrmgstedltarvldlaspigrgqrglivappkagktm
    llqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemv
    iekakrlvehkkdviilldsitrlarayntvvpavltggvdanalhrpkrffgaarnvee
    ggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrkee
    llttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pvoB (B:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpenarnkilfenltplhansrlrmergngstedltarvldlaspigrgqrglivapp
    kagktmllqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhv
    qvaemviekakrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrpkrf
    fgaarnveeggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidy
    nrsgtrkeellttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmkrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pvoB (B:)
    gdgvleilqdgfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegery
    fallkvnevnfdkpennkilfenltplhansrlrmgstedltarvldlaspigrgqrgli
    vappkagktmllqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepa
    srhvqvaemviekakrlvehkkdviilldsitrlarayntvvpavltggvdanalhrpkr
    ffgaarnveeggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaid
    ynrsgtrkeellttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1pvoC (C:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpenarnkilfenltplhansrlrmergngstedltarvldlaspigrgqrglivapp
    kagktmllqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhv
    qvaemviekakrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrpkrf
    fgaarnveeggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidy
    nrsgtrkeellttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmkrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pvoC (C:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpennkilfenltplhansrlrmgstedltarvldlaspigrgqrglivappkagktm
    llqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemv
    iekakrlvehkkdviilldsitrlarayntvvpavltggvdanalhrpkrffgaarnvee
    ggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrkee
    llttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1pvoD (D:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpenarnkilfenltplhansrlrmergngstedltarvldlaspigrgqrglivapp
    kagktmllqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhv
    qvaemviekakrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrpkrf
    fgaarnveeggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidy
    nrsgtrkeellttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmkrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pvoD (D:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpennkilfenltplhansrlrmgstedltarvldlaspigrgqrglivappkagktm
    llqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemv
    iekakrlvehkkdviilldsitrlarayntvvpavltggvdanalhrpkrffgaarnvee
    ggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrkee
    llttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1pvoE (E:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpenarnkilfenltplhansrlrmergngstedltarvldlaspigrgqrglivapp
    kagktmllqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhv
    qvaemviekakrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrpkrf
    fgaarnveeggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidy
    nrsgtrkeellttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmkrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pvoE (E:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpennkilfenltplhansrlrmgstedltarvldlaspigrgqrglivappkagktm
    llqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemv
    iekakrlvehkkdviilldsitrlarayntvvpaltggvdanalhrpkrffgaarnveeg
    gsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrkeel
    lttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1pvoF (F:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpenarnkilfenltplhansrlrmergngstedltarvldlaspigrgqrglivapp
    kagktmllqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhv
    qvaemviekakrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrpkrf
    fgaarnveeggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidy
    nrsgtrkeellttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmkrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pvoF (F:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpennkilfenltplhansrlrmgstedltarvldlaspigrgqrglivappkagktm
    llqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemv
    iekakrlvehkkdviilldsitrlarayntvvpavltggvdanalhrpkrffgaarnvee
    ggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrkee
    llttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk