PDB entry 1pvn

View 1pvn on RCSB PDB site
Description: The crystal structure of the complex between IMP dehydrogenase catalytic domain and a transition state analogue MZP
Class: oxidoreductase
Keywords: Transition state analogue, IMP dehydrogenase, Mizoribine 5'-monophosphate, distal flap, general base, drug selectivity, OXIDOREDUCTASE
Deposited on 2003-06-27, released 2003-07-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-02, with a file datestamp of 2017-07-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: -1.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inosine-5'-monophosphate dehydrogenase
    Species: Tritrichomonas foetus [TaxId:5724]
    Gene: IMPDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pvna1
  • Chain 'B':
    Compound: inosine-5'-monophosphate dehydrogenase
    Species: Tritrichomonas foetus [TaxId:5724]
    Gene: IMPDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pvnb1
  • Chain 'C':
    Compound: inosine-5'-monophosphate dehydrogenase
    Species: Tritrichomonas foetus [TaxId:5724]
    Gene: IMPDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pvnc1
  • Chain 'D':
    Compound: inosine-5'-monophosphate dehydrogenase
    Species: Tritrichomonas foetus [TaxId:5724]
    Gene: IMPDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pvnd1
  • Heterogens: K, MZP, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pvnA (A:)
    akyynepchtfneyllipglstvdcipsnvnlstplvkfqkgqqseinlkiplvsaimqs
    vsgekmaialareggisfifgsqsiesqaamvhavknfkdsqkrylvgagintrdfrerv
    palveagadvlcidssdgfsewqkitigwirekygdkvkvgagnivdgegfryladagad
    fikigigggsicitreqkgigrgqatavidvvaernkyfeetgiyipvcsdggivydyhm
    tlalamgadfimlgryfarfeesptrkvtingsvmkeywgegssrarnwqrydlggkqkl
    sfeegvdsyvpyagklkdnveaslnkvkstmcncgaltipqlqskakitlvssvsivegg
    ahdvivkdrindyhpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pvnA (A:)
    akyynepchtfneyllipglstvdcipsnvnlstplvkfqkgqqseinlkiplvsaimqs
    vsgekmaialareggisfifgsqsiesqaamvhavknfrylvgagintrdfrervpalve
    agadvlcidssdgfsewqkitigwirekygdkvkvgagnivdgegfryladagadfikig
    igggsicitreqkgigrgqatavidvvaernkyfeetgiyipvcsdggivydyhmtlala
    mgadfimlgryfarfeesptrkvtingsvmkeywgegssrarnwqrydlggkqklsfeeg
    vdsyvpyagklkdnveaslnkvkstmcncgaltipqlqskakitlvssvsiveggahdvi
    vk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pvnB (B:)
    akyynepchtfneyllipglstvdcipsnvnlstplvkfqkgqqseinlkiplvsaimqs
    vsgekmaialareggisfifgsqsiesqaamvhavknfkdsqkrylvgagintrdfrerv
    palveagadvlcidssdgfsewqkitigwirekygdkvkvgagnivdgegfryladagad
    fikigigggsicitreqkgigrgqatavidvvaernkyfeetgiyipvcsdggivydyhm
    tlalamgadfimlgryfarfeesptrkvtingsvmkeywgegssrarnwqrydlggkqkl
    sfeegvdsyvpyagklkdnveaslnkvkstmcncgaltipqlqskakitlvssvsivegg
    ahdvivkdrindyhpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pvnB (B:)
    akyynepchtfneyllipglstvdcipsnvnlstplvkfqkgqqseinlkiplvsaimqs
    vsgekmaialareggisfifgsqsiesqaamvhavknfrylvgagintrdfrervpalve
    agadvlcidssdgfsewqkitigwirekygdkvkvgagnivdgegfryladagadfikig
    igggsicitreqkgigrgqatavidvvaernkyfeetgiyipvcsdggivydyhmtlala
    mgadfimlgryfarfeesptrkvtingsvmkeywgegssrarnwqrydlggkqklsfeeg
    vdsyvpyagklkdnveaslnkvkstmcncgaltipqlqskakitlvssvsiveggahdvi
    vk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1pvnC (C:)
    akyynepchtfneyllipglstvdcipsnvnlstplvkfqkgqqseinlkiplvsaimqs
    vsgekmaialareggisfifgsqsiesqaamvhavknfkdsqkrylvgagintrdfrerv
    palveagadvlcidssdgfsewqkitigwirekygdkvkvgagnivdgegfryladagad
    fikigigggsicitreqkgigrgqatavidvvaernkyfeetgiyipvcsdggivydyhm
    tlalamgadfimlgryfarfeesptrkvtingsvmkeywgegssrarnwqrydlggkqkl
    sfeegvdsyvpyagklkdnveaslnkvkstmcncgaltipqlqskakitlvssvsivegg
    ahdvivkdrindyhpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pvnC (C:)
    akyynepchtfneyllipglstvdcipsnvnlstplvkfqkgqqseinlkiplvsaimqs
    vsgekmaialareggisfifgsqsiesqaamvhavknfrylvgagintrdfrervpalve
    agadvlcidssdgfsewqkitigwirekygdkvkvgagnivdgegfryladagadfikig
    igggsicitreqkgigrgqatavidvvaernkyfeetgiyipvcsdggivydyhmtlala
    mgadfimlgryfarfeesptrkvtingsvmkeywgegssrarnwqrydlggkqklsfeeg
    vdsyvpyagklkdnveaslnkvkstmcncgaltipqlqskakitlvssvsiveggahdvi
    vk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1pvnD (D:)
    akyynepchtfneyllipglstvdcipsnvnlstplvkfqkgqqseinlkiplvsaimqs
    vsgekmaialareggisfifgsqsiesqaamvhavknfkdsqkrylvgagintrdfrerv
    palveagadvlcidssdgfsewqkitigwirekygdkvkvgagnivdgegfryladagad
    fikigigggsicitreqkgigrgqatavidvvaernkyfeetgiyipvcsdggivydyhm
    tlalamgadfimlgryfarfeesptrkvtingsvmkeywgegssrarnwqrydlggkqkl
    sfeegvdsyvpyagklkdnveaslnkvkstmcncgaltipqlqskakitlvssvsivegg
    ahdvivkdrindyhpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pvnD (D:)
    akyynepchtfneyllipglstvdcipsnvnlstplvkfqkgqqseinlkiplvsaimqs
    vsgekmaialareggisfifgsqsiesqaamvhavknfrylvgagintrdfrervpalve
    agadvlcidssdgfsewqkitigwirekygdkvkvgagnivdgegfryladagadfikig
    igggsicitreqkgigrgqatavidvvaernkyfeetgiyipvcsdggivydyhmtlala
    mgadfimlgryfarfeesptrkvtingsvmkeywgegssrarnwqrydlggkqklsfeeg
    vdsyvpyagklkdnveaslnkvkstmcncgaltipqlqskakitlvssvsiveggahdvi
    vk