PDB entry 1pvm

View 1pvm on RCSB PDB site
Description: Crystal Structure of a Conserved CBS Domain Protein TA0289 of Unknown Function from Thermoplasma acidophilum
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, CBS domain, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2003-06-27, released 2004-01-20
The last revision prior to the SCOP 1.73 freeze date was dated 2005-01-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.194
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein Ta0289
    Species: Thermoplasma acidophilum
    Gene: Ta0289
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HLD9 (6-183)
      • conflict (114)
    Domains in SCOP 1.73: d1pvma1, d1pvma2, d1pvma3
  • Chain 'B':
    Compound: conserved hypothetical protein Ta0289
    Species: Thermoplasma acidophilum
    Gene: Ta0289
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HLD9 (6-183)
      • cloning artifact (0-5)
      • conflict (114)
    Domains in SCOP 1.73: d1pvmb1, d1pvmb2, d1pvmb3
  • Heterogens: HG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pvmA (A:)
    vprgghmfmrvekimnsnfktvnwnttvfdavkimnenhlyglvvkddngndvgllsers
    iikrfiprnkkpdevpirlvmrkpipkvksdydvkdvaaylsenglercavvddpgrvvg
    ivtltdlsrylsrasitdillshrtkdyqhlcpkcgvgvlepvynekgeikvfrcsnpac
    dyee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pvmA (A:)
    mfmrvekimnsnfktvnwnttvfdavkimnenhlyglvvkddngndvgllsersiikrfi
    prnkkpdevpirlvmrkpipkvksdydvkdvaaylsenglercavvddpgrvvgivtltd
    lsrylsrasitdillshrtkdyqhlcpkcgvgvlepvynekgeikvfrcsnpacdyee
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pvmB (B:)
    vprgghmfmrvekimnsnfktvnwnttvfdavkimnenhlyglvvkddngndvgllsers
    iikrfiprnkkpdevpirlvmrkpipkvksdydvkdvaaylsenglercavvddpgrvvg
    ivtltdlsrylsrasitdillshrtkdyqhlcpkcgvgvlepvynekgeikvfrcsnpac
    dyee