PDB entry 1pvm

View 1pvm on RCSB PDB site
Description: crystal structure of a conserved cbs domain protein ta0289 of unknown function from thermoplasma acidophilum
Deposited on 2003-06-27, released 2004-01-20
The last revision prior to the SCOP 1.69 freeze date was dated 2004-01-20, with a file datestamp of 2004-01-20.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.194
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pvmA (A:)
    vprgghmfmrvekimnsnfktvnwnttvfdavkimnenhlyglvvkddngndvgllsers
    iikrfiprnkkpdevpirlvmrkpipkvksdydvkdvaaylsenglercavvddpgrvvg
    ivtltdlsrylsrasitdillshrtkdyqhlcpkcgvgvlepvynekgeikvfrcsnpac
    dyee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pvmA (A:)
    mfmrvekimnsnfktvnwnttvfdavkimnenhlyglvvkddngndvgllsersiikrfi
    prnkkpdevpirlvmrkpipkvksdydvkdvaaylsenglercavvddpgrvvgivtltd
    lsrylsrasitdillshrtkdyqhlcpkcgvgvlepvynekgeikvfrcsnpacdyee
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pvmB (B:)
    vprgghmfmrvekimnsnfktvnwnttvfdavkimnenhlyglvvkddngndvgllsers
    iikrfiprnkkpdevpirlvmrkpipkvksdydvkdvaaylsenglercavvddpgrvvg
    ivtltdlsrylsrasitdillshrtkdyqhlcpkcgvgvlepvynekgeikvfrcsnpac
    dyee