PDB entry 1pvi

View 1pvi on RCSB PDB site
Description: structure of pvuii endonuclease with cognate DNA
Class: hydrolase/DNA
Keywords: protein-DNA complex, hydrolase/DNA complex
Deposited on 1994-11-16, released 1995-02-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.189
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (pvuii (e.c.3.1.21.4))
    Species: Proteus vulgaris [TaxId:585]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pvia_
  • Chain 'B':
    Compound: protein (pvuii (e.c.3.1.21.4))
    Species: Proteus vulgaris [TaxId:585]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pvib_
  • Chain 'C':
    Compound: DNA (5'-d(*tp*gp*ap*cp*cp*ap*gp*cp*tp*gp*gp*tp*c)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*tp*gp*ap*cp*cp*ap*gp*cp*tp*gp*gp*tp*c)-3')

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pviA (A:)
    mshpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgregndav
    dnagqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdl
    efyydkwerkwysdghkdinnpkipvkyvmehgtkiy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pviA (A:)
    shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgregndavd
    nagqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdle
    fyydkwerkwysdghkdinnpkipvkyvmehgtkiy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pviB (B:)
    mshpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgregndav
    dnagqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdl
    efyydkwerkwysdghkdinnpkipvkyvmehgtkiy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pviB (B:)
    shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgregndavd
    nagqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdle
    fyydkwerkwysdghkdinnpkipvkyvmehgtkiy
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.