PDB entry 1pvh

View 1pvh on RCSB PDB site
Description: Crystal structure of leukemia inhibitory factor in complex with gp130
Class: signaling protein/cytokine
Keywords: cytokine, receptor, signaling, beta sheet, four helix bundle
Deposited on 2003-06-27, released 2003-10-14
The last revision prior to the SCOP 1.73 freeze date was dated 2004-11-30, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.248
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interleukin-6 receptor beta chain
    Species: HOMO SAPIENS
    Gene: IL6ST
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1pvha1, d1pvha2
  • Chain 'B':
    Compound: leukemia inhibitory factor
    Species: HOMO SAPIENS
    Gene: LIF OR HILDA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1pvhb_
  • Chain 'C':
    Compound: interleukin-6 receptor beta chain
    Species: HOMO SAPIENS
    Gene: IL6ST
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1pvhc1, d1pvhc2
  • Chain 'D':
    Compound: leukemia inhibitory factor
    Species: HOMO SAPIENS
    Gene: LIF OR HILDA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1pvhd_
  • Heterogens: IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pvhA (A:)
    glppekpknlscivnegkkmrcewdggrethletnftlksewathkfadckakrdtptsc
    tvdystvyfvnievwveaenalgkvtsdhinfdpvykvkpnpphnlsvinseelssilkl
    twtnpsiksviilkyniqyrtkdastwsqippedtastrssftvqdlkpfteyvfrircm
    kedgkgywsdwseeasgitye
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pvhB (B:)
    cairhpchnnlmnqirsqlaqlngsanalfilyytaqgepfpnnldklcgpnvtdfppfh
    angtekaklvelyrivvylgtslgnitrdqkilnpsalslhsklnatadilrgllsnvlc
    rlcskyhvghvdvtygpdtsgkdvfqkkklgcqllgkykqiiavlaqaf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pvhC (C:)
    glppekpknlscivnegkkmrcewdggrethletnftlksewathkfadckakrdtptsc
    tvdystvyfvnievwveaenalgkvtsdhinfdpvykvkpnpphnlsvinseelssilkl
    twtnpsiksviilkyniqyrtkdastwsqippedtastrssftvqdlkpfteyvfrircm
    kedgkgywsdwseeasgitye
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pvhD (D:)
    cairhpchnnlmnqirsqlaqlngsanalfilyytaqgepfpnnldklcgpnvtdfppfh
    angtekaklvelyrivvylgtslgnitrdqkilnpsalslhsklnatadilrgllsnvlc
    rlcskyhvghvdvtygpdtsgkdvfqkkklgcqllgkykqiiavlaqaf