PDB entry 1pvg

View 1pvg on RCSB PDB site
Description: Crystal Structure of the ATPase region of Saccharomyces Cerevisiae topoisomerase II
Class: isomerase
Keywords: GHKL ATPase domain, ISOMERASE
Deposited on 2003-06-27, released 2003-08-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.209
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA topoisomerase II
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: TOP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06786
      • modified residue (53)
      • modified residue (85)
      • modified residue (123)
      • modified residue (181)
      • modified residue (212)
      • modified residue (223)
      • modified residue (316)
      • modified residue (353)
      • modified residue (396)
      • modified residue (404)
    Domains in SCOPe 2.05: d1pvga1, d1pvga2
  • Chain 'B':
    Compound: DNA topoisomerase II
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: TOP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06786
      • modified residue (53)
      • modified residue (85)
      • modified residue (123)
      • modified residue (181)
      • modified residue (212)
      • modified residue (223)
      • modified residue (316)
      • modified residue (353)
      • modified residue (396)
      • modified residue (404)
    Domains in SCOPe 2.05: d1pvgb1, d1pvgb2
  • Heterogens: MG, ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pvgA (A:)
    ghmvtmstepvsasdkyqkisqlehilkrpdtyigsvetqeqlqwiydeetdcmieknvt
    ivpglfkifdeilvnaadnkvrdpsmkridvnihaeehtievkndgkgipieihnkeniy
    ipemifghlltssnydddekkvtggrngygaklcnifstefiletadlnvgqkyvqkwen
    nmsichppkitsykkgpsytkvtfkpdltrfgmkeldndilgvmrrrvydingsvrdinv
    ylngkslkirnfknyvelylkslekkrqldngedgaaksdiptilyerinnrwevafavs
    disfqqisfvnsiattmggthvnyitdqivkkiseilkkkkkksvksfqiknnmfifinc
    lienpaftsqtkeqlttrvkdfgsrceipleyinkimktdlatrmfeiadaneenalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pvgA (A:)
    sasdkyqkisqlehilkrpdtyigsvetqeqlqwiydeetdcmieknvtivpglfkifde
    ilvnaadnkvrdpsmkridvnihaeehtievkndgkgipieihnkeniyipemifghllt
    ssnydddekkvtggrngygaklcnifstefiletadlnvgqkyvqkwennmsichppkit
    sykkgpsytkvtfkpdltrfgmkeldndilgvmrrrvydingsvrdinvylngkslkirn
    fknyvelylksliptilyerinnrwevafavsdisfqqisfvnsiattmggthvnyitdq
    ivkkiseilkkvksfqiknnmfifinclienpaftsqtkeqlttrvkdfgsrceipleyi
    nkimktdlatrmfeiada
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pvgB (B:)
    ghmvtmstepvsasdkyqkisqlehilkrpdtyigsvetqeqlqwiydeetdcmieknvt
    ivpglfkifdeilvnaadnkvrdpsmkridvnihaeehtievkndgkgipieihnkeniy
    ipemifghlltssnydddekkvtggrngygaklcnifstefiletadlnvgqkyvqkwen
    nmsichppkitsykkgpsytkvtfkpdltrfgmkeldndilgvmrrrvydingsvrdinv
    ylngkslkirnfknyvelylkslekkrqldngedgaaksdiptilyerinnrwevafavs
    disfqqisfvnsiattmggthvnyitdqivkkiseilkkkkkksvksfqiknnmfifinc
    lienpaftsqtkeqlttrvkdfgsrceipleyinkimktdlatrmfeiadaneenalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pvgB (B:)
    asdkyqkisqlehilkrpdtyigsvetqeqlqwiydeetdcmieknvtivpglfkifdei
    lvnaadnkvrdpsmkridvnihaeehtievkndgkgipieihnkeniyipemifghllts
    snydddekkvtggrngygaklcnifstefiletadlnvgqkyvqkwennmsichppkits
    ykkgpsytkvtfkpdltrfgmkeldndilgvmrrrvydingsvrdinvylngkslkirnf
    knyvelylksleiptilyerinnrwevafavsdisfqqisfvnsiattmggthvnyitdq
    ivkkiseilkksvksfqiknnmfifinclienpaftsqtkeqlttrvkdfgsrceipley
    inkimktdlatrmfeiad