PDB entry 1pvf

View 1pvf on RCSB PDB site
Description: E.coli IPP isomerase in complex with diphosphate
Deposited on 2003-06-27, released 2004-07-06
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-06, with a file datestamp of 2004-07-06.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.199
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1pvfa_
  • Chain 'B':
    Domains in SCOP 1.69: d1pvfb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pvfA (A:)
    mqtehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpg
    vwtnsvcghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpv
    faarttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftq
    lkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pvfA (A:)
    ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt
    nsvcghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpvfaa
    rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaft
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pvfB (B:)
    mqtehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpg
    vwtnsvcghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpv
    faarttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftq
    lkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pvfB (B:)
    ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt
    nsvcghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpvfaa
    rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftqlkl