PDB entry 1pvd

View 1pvd on RCSB PDB site
Description: crystal structure of the thiamin diphosphate dependent enzyme pyruvate decarboxylase from the yeast saccharomyces cerevisiae at 2.3 angstroms resolution
Deposited on 1995-04-20, released 1995-07-31
The last revision prior to the SCOP 1.59 freeze date was dated 1995-07-31, with a file datestamp of 1995-08-14.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.165
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pvdA (A:)
    seitlgkylferlkqvnvntvfglpgdfnlslldkiyevegmrwagnanelnaayaadgy
    arikgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsishhtlgngdftvfhrms
    anisettamitdiatapaeidrcirttyvtqrpvylglpanlvdlnvpakllqtpidmsl
    kpndaesekevidtilalvkdaknpviladaccsrhdvkaetkklidltqfpafvtpmgk
    gsiseqhpryggvyvgtlskpevkeavesadlilsvgallsdktknivefhsdhmkirna
    tfpgvqmkfvlqklltniadaakgykpvavpartpanaavpastplkqewmwnqlgnflq
    egdvviaetgtsafginqttfpnntygisqvlwgsigfttgatlgaafaaeeidpkkrvi
    lfigdgslqltvqeistmirwglkpylfvlnndgytieklihgpkaqyneiqgwdhlsll
    ptfgakdyethrvattgewdkltqdksfndnskirmieimlpvfdapqnlvkqaklt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pvdB (B:)
    seitlgkylferlkqvnvntvfglpgdfnlslldkiyevegmrwagnanelnaayaadgy
    arikgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsishhtlgngdftvfhrms
    anisettamitdiatapaeidrcirttyvtqrpvylglpanlvdlnvpakllqtpidmsl
    kpndaesekevidtilalvkdaknpviladaccsrhdvkaetkklidltqfpafvtpmgk
    gsiseqhpryggvyvgtlskpevkeavesadlilsvgallsdktknivefhsdhmkirna
    tfpgvqmkfvlqklltniadaakgykpvavpartpanaavpastplkqewmwnqlgnflq
    egdvviaetgtsafginqttfpnntygisqvlwgsigfttgatlgaafaaeeidpkkrvi
    lfigdgslqltvqeistmirwglkpylfvlnndgytieklihgpkaqyneiqgwdhlsll
    ptfgakdyethrvattgewdkltqdksfndnskirmieimlpvfdapqnlvkqaklt