PDB entry 1pvc

View 1pvc on RCSB PDB site
Description: refinement of the sabin strain of type 3 poliovirus at 2.4 angstroms and the crystal structures of its variants at 2.9 angstroms resolution
Class: Virus
Keywords: VIRUS, Icosahedral virus
Deposited on 1995-03-30, released 1995-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.205
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Compound: poliovirus type 3, sabin strain
    Species: Poliovirus type 3 (strains P3/LEON/37 AND P3/LEON 12A[1]B) [TaxId:12088]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PVC (0-3)
  • Chain '1':
    Compound: poliovirus type 3, sabin strain
    Species: Poliovirus type 3 (strains P3/LEON/37 AND P3/LEON 12A[1]B) [TaxId:12088]
    Database cross-references and differences (RAF-indexed):
    • PIR S03822 (Start-300)
    Domains in SCOPe 2.07: d1pvc1_
  • Chain '2':
    Compound: poliovirus type 3, sabin strain
    Species: Poliovirus type 3 (strains P3/LEON/37 AND P3/LEON 12A[1]B) [TaxId:12088]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pvc.1
  • Chain '3':
    Compound: poliovirus type 3, sabin strain
    Species: Poliovirus type 3 (strains P3/LEON/37 AND P3/LEON 12A[1]B) [TaxId:12088]
    Database cross-references and differences (RAF-indexed):
    • PIR S03822 (0-End)
    Domains in SCOPe 2.07: d1pvc3_
  • Chain '4':
    Compound: poliovirus type 3, sabin strain
    Species: Poliovirus type 3 (strains P3/LEON/37 AND P3/LEON 12A[1]B) [TaxId:12088]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pvc.1
  • Heterogens: MYR, SPH, HOH

PDB Chain Sequences:

  • Chain '0':
    No sequence available.

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >1pvc1 (1:)
    qgiedlisevaqgaltlslpkqqdslpdtkasgpahskevpaltavetgatnplapsdtv
    qtrhvvqrrsrsestiesffargacvaiievdneqpttraqklfamwritykdtvqlrrk
    lefftysrfdmeftfvvtanftnannghalnqvyqimyippgaptpkswddytwqtssnp
    sifytygaaparisvpyvglanayshfydgfakvplktdandqigdslysamtvddfgvl
    avrvvndhnptkvtskvriymkpkhvrvwcprppravpyygpgvdyrnnldplsekgltt
    y
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pvc1 (1:)
    qdslpdtkasgpahskevpaltavetgatnplapsdtvqtrhvvqrrsrsestiesffar
    gacvaiievdneqpttraqklfamwritykdtvqlrrklefftysrfdmeftfvvtanft
    nannghalnqvyqimyippgaptpkswddytwqtssnpsifytygaaparisvpyvglan
    ayshfydgfakvplktdandqigdslysamtvddfgvlavrvvndhnptkvtskvriymk
    pkhvrvwcprppravpyygpgvdyrnnldplsekgltty
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >1pvc2 (2:)
    spnveacgysdrvlqltlgnstittqeaansvvaygrwpefirddeanpvdqptepdvat
    crfytldtvmwgkeskgwwwklpdalrdmglfgqnmyyhylgrsgytvhvqcnaskfhqg
    algvfaipeyclagdsdkqrytsyananpgerggkfysqfnkdnavtspkrefcpvdyll
    gcgvllgnafvyphqiinlrtnnsativlpyvnalaidsmvkhnnwgiailplspldfaq
    dssveipitvtiapmcsefnglrnvtapkfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pvc2 (2:)
    acgysdrvlqltlgnstittqeaansvvaygrwpefirddeanpvdqptepdvatcrfyt
    ldtvmwgkeskgwwwklpdalrdmglfgqnmyyhylgrsgytvhvqcnaskfhqgalgvf
    aipeyclagdsdkqrytsyananpgerggkfysqfnkdnavtspkrefcpvdyllgcgvl
    lgnafvyphqiinlrtnnsativlpyvnalaidsmvkhnnwgiailplspldfaqdssve
    ipitvtiapmcsefnglrnvtapkfq
    

  • Chain '3':
    Sequence, based on SEQRES records: (download)
    >1pvc3 (3:)
    glpvlntpgsnqyltsdnhqspcaipefdvtppidipgevknmmelaeidtmiplnlest
    krntmdmyrvtlsdsadlsqpilclslspafdprlshtmlgevlnyythwagslkftflf
    cgsmmatgkilvayappgaqpptsrkeamlgthviwdlglqssctmvvpwisnvtyrqtt
    qdsfteggyismfyqtrivvplstpksmsmlgfvsacndfsvrllrdtthisqsalpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pvc3 (3:)
    glpvlntpgsnqyltsdnhqspcaipefdvtppidipgevknmmelaeidtmiplnlest
    krntmdmyrvtlsdsadlsqpilclslspafdprlshtmlgevlnyythwagslkftflf
    cgsmmatgkilvayappgaqpptsrkeamlgthviwdlglqssctmvvpwisnvtyrqtt
    qdsfteggyismfyqtrivvplstpksmsmlgfvsacndfsvrllrdtthisqsa
    

  • Chain '4':
    Sequence, based on SEQRES records: (download)
    >1pvc4 (4:)
    gaqvssqkvgahensnrayggstinyttinyykdsasnaaskqdysqdpskfteplkdvl
    iktapaln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pvc4 (4:)
    gaqvssqkvgahensstinyttinyykdsasnaaskqdysqdpskfteplkdvliktapa
    ln