PDB entry 1pvb

View 1pvb on RCSB PDB site
Description: x-ray structure of a new crystal form of pike 4.10 parvalbumin
Class: calcium binding protein
Keywords: calcium binding protein
Deposited on 1995-01-05, released 1995-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.168
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: parvalbumin
    Species: Esox lucius [TaxId:8010]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pvba_
  • Heterogens: CA, NH4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pvbA (A:)
    sfaglkdadvaaalaacsaadsfkhkeffakvglaskslddvkkafyvidqdksgfieed
    elklflqnfspsaraltdaetkafladgdkdgdgmigvdefaamika