PDB entry 1pv8

View 1pv8 on RCSB PDB site
Description: Crystal structure of a low activity F12L mutant of human porphobilinogen synthase
Class: lyase
Keywords: PORPHOBILINOGEN SYNTHASE, TETRAPYRROLE BIOSYNTHESIS, REACTION INTERMEDIATE, lyase
Deposited on 2003-06-26, released 2003-09-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.199
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: delta-aminolevulinic acid dehydratase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALAD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13716 (Start-329)
      • engineered (11)
    Domains in SCOPe 2.08: d1pv8a_
  • Chain 'B':
    Compound: delta-aminolevulinic acid dehydratase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALAD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13716
      • engineered (11)
    Domains in SCOPe 2.08: d1pv8b_
  • Heterogens: ZN, PB1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pv8A (A:)
    mqpqsvlhsgylhpllrawqtatttlnasnliypifvtdvpddiqpitslpgvarygvkr
    leemlrplveeglrcvlifgvpsrvpkdergsaadseespaieaihllrktfpnllvacd
    vclcpytshghcgllsengafraeesrqrlaevalayakagcqvvapsdmmdgrveaike
    almahglgnrvsvmsysakfascfygpfrdaaksspafgdrrcyqlppgarglalravdr
    dvregadmlmvkpgmpyldivrevkdkhpdlplavyhvsgefamlwhgaqagafdlkaav
    leamtafrragadiiityytpqllqwlkee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pv8A (A:)
    ylhpllrawqtatttlnasnliypifvtdvpddiqpitslpgvarygvkrleemlrplve
    eglrcvlifgvpeespaieaihllrktfpnllvacdvclcafraeesrqrlaevalayak
    agcqvvapsddgrveaikealmahglgnrvsvmsysakfascfygpfrdaalppgargla
    lravdrdvregadmlmvkpgmpyldivrevkdkhpdlplavyhvsgefamlwhgaqagaf
    dlkaavleamtafrragadiiityytpqllqwlkee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pv8B (B:)
    mqpqsvlhsgylhpllrawqtatttlnasnliypifvtdvpddiqpitslpgvarygvkr
    leemlrplveeglrcvlifgvpsrvpkdergsaadseespaieaihllrktfpnllvacd
    vclcpytshghcgllsengafraeesrqrlaevalayakagcqvvapsdmmdgrveaike
    almahglgnrvsvmsysakfascfygpfrdaaksspafgdrrcyqlppgarglalravdr
    dvregadmlmvkpgmpyldivrevkdkhpdlplavyhvsgefamlwhgaqagafdlkaav
    leamtafrragadiiityytpqllqwlkee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pv8B (B:)
    pqsvlhsgylhpllrawqtatttlnasnliypifvtdvpddiqpitslpgvarygvkrle
    emlrplveeglrcvlifgvpeespaieaihllrktfpnllvacdvcafraeesrqrlaev
    alayakagcqvvapsddgrveaikealmahglgnrvsvmsysakfascfygpfrdaalpp
    garglalravdrdvregadmlmvkpgmpyldivrevkdkhpdlplavyhvsgefamlwhg
    aqagafdlkaavleamtafrragadiiityytpqllqwlk