PDB entry 1pv4

View 1pv4 on RCSB PDB site
Description: X-ray crystal structure of the Rho transcription termination factor in complex with single stranded DNA
Class: Transcription/DNA
Keywords: PROTEIN-ssDNA COMPLEX, Transcription-DNA COMPLEX
Deposited on 2003-06-26, released 2003-07-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.271
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcription termination factor rho
    Species: Escherichia coli [TaxId:562]
    Gene: RHO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AG30 (0-End)
      • modified residue (0)
      • modified residue (20)
      • modified residue (28)
      • modified residue (146)
      • modified residue (185)
      • modified residue (204)
      • modified residue (218)
      • modified residue (244)
      • modified residue (326)
      • modified residue (340)
      • modified residue (379)
      • modified residue (389)
      • modified residue (395)
      • modified residue (404)
      • modified residue (414-415)
    Domains in SCOPe 2.07: d1pv4a1, d1pv4a2, d1pv4a3
  • Chain 'B':
    Compound: transcription termination factor rho
    Species: Escherichia coli [TaxId:562]
    Gene: RHO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AG30
      • modified residue (146)
      • modified residue (185)
      • modified residue (204)
      • modified residue (218)
      • modified residue (244)
      • modified residue (326)
      • modified residue (340)
      • modified residue (379)
      • modified residue (389)
      • modified residue (395)
      • modified residue (404)
      • modified residue (414-415)
    Domains in SCOPe 2.07: d1pv4b1, d1pv4b2
  • Chain 'C':
    Compound: transcription termination factor rho
    Species: Escherichia coli [TaxId:562]
    Gene: RHO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AG30 (0-End)
      • modified residue (0)
      • modified residue (20)
      • modified residue (28)
      • modified residue (146)
      • modified residue (185)
      • modified residue (204)
      • modified residue (218)
      • modified residue (244)
      • modified residue (326)
      • modified residue (340)
      • modified residue (379)
      • modified residue (389)
      • modified residue (395)
      • modified residue (404)
      • modified residue (414-415)
    Domains in SCOPe 2.07: d1pv4c1, d1pv4c2, d1pv4c3
  • Chain 'D':
    Compound: transcription termination factor rho
    Species: Escherichia coli [TaxId:562]
    Gene: RHO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AG30 (0-End)
      • modified residue (0)
      • modified residue (20)
      • modified residue (28)
      • modified residue (146)
      • modified residue (185)
      • modified residue (204)
      • modified residue (218)
      • modified residue (244)
      • modified residue (326)
      • modified residue (340)
      • modified residue (379)
      • modified residue (389)
      • modified residue (395)
      • modified residue (404)
      • modified residue (414-415)
    Domains in SCOPe 2.07: d1pv4d1, d1pv4d2, d1pv4d3
  • Chain 'E':
    Compound: transcription termination factor rho
    Species: Escherichia coli [TaxId:562]
    Gene: RHO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AG30 (0-End)
      • modified residue (0)
      • modified residue (20)
      • modified residue (28)
      • modified residue (146)
      • modified residue (185)
      • modified residue (204)
      • modified residue (218)
      • modified residue (244)
      • modified residue (326)
      • modified residue (340)
      • modified residue (379)
      • modified residue (389)
      • modified residue (395)
      • modified residue (404)
      • modified residue (414-415)
    Domains in SCOPe 2.07: d1pv4e1, d1pv4e2, d1pv4e3
  • Chain 'F':
    Compound: transcription termination factor rho
    Species: Escherichia coli [TaxId:562]
    Gene: RHO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AG30 (0-End)
      • modified residue (0)
      • modified residue (20)
      • modified residue (28)
      • modified residue (146)
      • modified residue (185)
      • modified residue (204)
      • modified residue (218)
      • modified residue (244)
      • modified residue (326)
      • modified residue (340)
      • modified residue (379)
      • modified residue (389)
      • modified residue (395)
      • modified residue (404)
      • modified residue (414-415)
    Domains in SCOPe 2.07: d1pv4f1, d1pv4f2, d1pv4f3
  • Chain 'G':
    Compound: 5'-d(p*cp*c)-3'
    Species: synthetic, synthetic
  • Chain 'H':
    Compound: 5'-d(p*cp*c)-3'
    Species: synthetic, synthetic
  • Chain 'J':
    Compound: 5'-d(p*cp*c)-3'
    Species: synthetic, synthetic
  • Chain 'K':
    Compound: 5'-d(p*cp*c)-3'
    Species: synthetic, synthetic
  • Chain 'L':
    Compound: 5'-d(p*cp*c)-3'
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pv4A (A:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpenarnkilfenltplhansrlrmergngstedltarvldlaspigrgqrglivapp
    kagktmllqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhv
    qvaemviekakrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrpkrf
    fgaarnveeggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidy
    nrsgtrkeellttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmkrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pv4A (A:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpennkilfenltplhansrlrmgstedltarvldlaspigrgqrglivappkagktm
    llqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemv
    iekakrlvehkkdviilldsitrlarayntvvpavltggvdanalhrpkrffgaarnvee
    ggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrkee
    llttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pv4B (B:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpenarnkilfenltplhansrlrmergngstedltarvldlaspigrgqrglivapp
    kagktmllqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhv
    qvaemviekakrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrpkrf
    fgaarnveeggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidy
    nrsgtrkeellttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmkrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pv4B (B:)
    gdgvleilqdgfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegery
    fallkvnevnfdkpennkilfenltplhansrlrmgstedltarvldlaspigrgqrgli
    vappkagktmllqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepa
    srhvqvaemviekakrlvehkkdviilldsitrlarayntvvpavltggvdanalhrpkr
    ffgaarnveeggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaid
    ynrsgtrkeellttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1pv4C (C:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpenarnkilfenltplhansrlrmergngstedltarvldlaspigrgqrglivapp
    kagktmllqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhv
    qvaemviekakrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrpkrf
    fgaarnveeggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidy
    nrsgtrkeellttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmkrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pv4C (C:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpennkilfenltplhansrlrmgstedltarvldlaspigrgqrglivappkagktm
    llqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemv
    iekakrlvehkkdviilldsitrlarayntvvpavltggvdanalhrpkrffgaarnvee
    ggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrkee
    llttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1pv4D (D:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpenarnkilfenltplhansrlrmergngstedltarvldlaspigrgqrglivapp
    kagktmllqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhv
    qvaemviekakrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrpkrf
    fgaarnveeggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidy
    nrsgtrkeellttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmkrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pv4D (D:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpennkilfenltplhansrlrmgstedltarvldlaspigrgqrglivappkagktm
    llqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemv
    iekakrlvehkkdviilldsitrlarayntvvpavltggvdanalhrpkrffgaarnvee
    ggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrkee
    llttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1pv4E (E:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpenarnkilfenltplhansrlrmergngstedltarvldlaspigrgqrglivapp
    kagktmllqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhv
    qvaemviekakrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrpkrf
    fgaarnveeggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidy
    nrsgtrkeellttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmkrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pv4E (E:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpennkilfenltplhansrlrmgstedltarvldlaspigrgqrglivappkagktm
    llqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemv
    iekakrlvehkkdviilldsitrlarayntvvpaltggvdanalhrpkrffgaarnveeg
    gsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrkeel
    lttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1pv4F (F:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpenarnkilfenltplhansrlrmergngstedltarvldlaspigrgqrglivapp
    kagktmllqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhv
    qvaemviekakrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrpkrf
    fgaarnveeggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidy
    nrsgtrkeellttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmkrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pv4F (F:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpennkilfenltplhansrlrmgstedltarvldlaspigrgqrglivappkagktm
    llqniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemv
    iekakrlvehkkdviilldsitrlarayntvvpavltggvdanalhrpkrffgaarnvee
    ggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrkee
    llttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.