PDB entry 1pv3

View 1pv3 on RCSB PDB site
Description: NMR Solution Structure of the Avian FAT-domain of Focal Adhesion Kinase
Class: transferase
Keywords: Focal Adhesion Kinase, Helix Bundle, FAT-Domain, TRANSFERASE
Deposited on 2003-06-26, released 2004-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-04-27, with a file datestamp of 2016-04-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Focal adhesion kinase 1
  Species: Gallus gallus [TaxId:9031]
  Gene: FAK1 OR FAK
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q00944 (12-145)
    • cloning artifact (0-11)
  Domains in SCOPe 2.07: d1pv3a1, d1pv3a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pv3A (A:)
  gspgisgggggirsndkvyenvtglvkaviemsskiqpappeeyvpmvkevglalrtlla
  tvdeslpvlpasthreiemaqkllnsdlaelinkmklaqqyvmtslqqeykkqmltaaha
  lavdaknlldvidqarlkmisqsrph