PDB entry 1pv0

View 1pv0 on RCSB PDB site
Description: Structure of the Sda antikinase
Class: signaling protein
Keywords: Sda, KinA, antikinase, histidine kinase, sporulation phosphorelay, SIGNALING PROTEIN
Deposited on 2003-06-26, released 2004-04-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Sda
  Species: Bacillus subtilis [TaxId:1423]
  Gene: sda
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7WY62 (0-45)
  Domains in SCOPe 2.06: d1pv0a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pv0A (A:)
  mrklsdelliesyfkatemnlnrdfielieneikrrslghiisvss