PDB entry 1pv0

View 1pv0 on RCSB PDB site
Description: Structure of the Sda antikinase
Class: signaling protein
Keywords: Sda, KinA, antikinase, histidine kinase, sporulation phosphorelay, SIGNALING PROTEIN
Deposited on 2003-06-26, released 2004-04-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sda
    Species: Bacillus subtilis [TaxId:1423]
    Gene: sda
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pv0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pv0A (A:)
    mrklsdelliesyfkatemnlnrdfielieneikrrslghiisvss