PDB entry 1puz

View 1puz on RCSB PDB site
Description: Solution NMR Structure of Protein NMA1147 from Neisseria meningitidis. Northeast Structural Genomics Consortium Target MR19
Class: structural genomics, unknown function
Keywords: NMA1147, MR19, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, unknown function
Deposited on 2003-06-25, released 2004-06-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein
    Species: Neisseria meningitidis [TaxId:122586]
    Gene: NMA1147 OR NMB0952
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1puza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1puzA (A:)
mmvfddiakrkirfqtrrglleldlifgrfmekefehlsdkelsefseilefqdqellal
inghsetdkghlipmlekirra