PDB entry 1pux

View 1pux on RCSB PDB site
Description: NMR Solution Structure of BeF3-Activated Spo0F, 20 conformers
Class: transferase
Keywords: sporulation, (beta/alpha)5 barrel, response regulator, phosphorelay, beryllofluoride, two-component systems, TRANSFERASE
Deposited on 2003-06-25, released 2003-08-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sporulation initiation phosphotransferase f
    Species: Bacillus subtilis [TaxId:1423]
    Gene: SPO0F
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1puxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1puxA (A:)
mmnekilivddqygirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgm
dgieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylp
lksn