PDB entry 1pux

View 1pux on RCSB PDB site
Description: NMR Solution Structure of BeF3-Activated Spo0F, 20 conformers
Class: transferase
Keywords: sporulation, (beta/alpha)5 barrel, response regulator, phosphorelay, beryllofluoride, two-component systems
Deposited on 2003-06-25, released 2003-08-19
The last revision prior to the SCOP 1.73 freeze date was dated 2003-08-19, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sporulation initiation phosphotransferase f
    Species: Bacillus subtilis
    Gene: SPO0F
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1puxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1puxA (A:)
    mmnekilivddqygirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgm
    dgieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylp
    lksn