PDB entry 1pux

View 1pux on RCSB PDB site
Description: nmr solution structure of bef3-activated spo0f, 20 conformers
Deposited on 2003-06-25, released 2003-08-19
The last revision prior to the SCOP 1.71 freeze date was dated 2003-08-19, with a file datestamp of 2003-08-19.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1puxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1puxA (A:)
    mmnekilivddqygirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgm
    dgieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylp
    lksn