PDB entry 1puu

View 1puu on RCSB PDB site
Description: Mistletoe lectin I in complex with lactose
Class: sugar binding protein
Keywords: beta-trefoil, SUGAR BINDING PROTEIN
Deposited on 2003-06-25, released 2004-06-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.207
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin I A chain
    Species: Viscum album [TaxId:3972]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PUU (0-248)
    Domains in SCOPe 2.07: d1puua_
  • Chain 'B':
    Compound: lectin I B chain
    Species: Viscum album [TaxId:3972]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PUU (0-262)
    Domains in SCOPe 2.07: d1puub3, d1puub4
  • Heterogens: NAG, SO4, CL, DIO, GOL, LAT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1puuA (A:)
    yerlslrtvqqttgaeyfsfitllrdfvssgsfsnnipllrqstipvsegsrfvlveltn
    aggdsitaaidvtnlyvvayqagqqsyflkdapagaetqdfagttrsslpfngsypdler
    yaghrdqiplgidqliasvtalrfpggstrtqarsililiqmiseaarfnpilwrarqyi
    nsgasflpdvymleletswgqqstqvqhstdgvfnnpialalppgnvvtltnirdviasl
    aimlfvcge
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1puuB (B:)
    ddvtcsasepivrivgrngmtvdvrdddfqdgnqiqlwpsksnndpnqlwtikkdgtirs
    ngsclttygytagvyvmifdcntavreatiwqiwgngtiinprsnlvlaassgikgttlt
    vqtldytlgqgwlagndtaprettiygfrdlcmesnggsvwvetctagqenqrwalygdg
    sirpkqnqsqcltngrdsvstvinivscsagssgqrwvftnagailnlknglamdvaqan
    palsriiiypatgnpnqmwlpvp