PDB entry 1puu

View 1puu on RCSB PDB site
Description: mistletoe lectin i in complex with lactose
Deposited on 2003-06-25, released 2004-06-25
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-25, with a file datestamp of 2004-06-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.207
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1puuA (A:)
    yerlslrtvqqttgaeyfsfitllrdfvssgsfsnnipllrqstipvsegsrfvlveltn
    aggdsitaaidvtnlyvvayqagqqsyflkdapagaetqdfagttrsslpfngsypdler
    yaghrdqiplgidqliasvtalrfpggstrtqarsililiqmiseaarfnpilwrarqyi
    nsgasflpdvymleletswgqqstqvqhstdgvfnnpialalppgnvvtltnirdviasl
    aimlfvcge
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1puuB (B:)
    ddvtcsasepivrivgrngmtvdvrdddfqdgnqiqlwpsksnndpnqlwtikkdgtirs
    ngsclttygytagvyvmifdcntavreatiwqiwgngtiinprsnlvlaassgikgttlt
    vqtldytlgqgwlagndtaprettiygfrdlcmesnggsvwvetctagqenqrwalygdg
    sirpkqnqsqcltngrdsvstvinivscsagssgqrwvftnagailnlknglamdvaqan
    palsriiiypatgnpnqmwlpvp