PDB entry 1pus

View 1pus on RCSB PDB site
Description: solution structure of the mutt pyrophosphohydrolase complexed with mg(2+) and 8-oxo-dgmp, a tightly-bound product
Deposited on 2003-06-25, released 2003-08-26
The last revision prior to the SCOP 1.71 freeze date was dated 2004-01-27, with a file datestamp of 2004-01-27.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1pusa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pusA (A:)
    mkklqiavgiirnenneifitrraadahmanklefpggkiemgetpeqavvrelqeevgi
    tpqhfslfekleyefpdrhitlwfwlverwegepwgkegqpgewmslvglnaddfppane
    pviaklkrl