PDB entry 1puo

View 1puo on RCSB PDB site
Description: Crystal structure of Fel d 1- the major cat allergen
Class: allergen
Keywords: cat allergen, uteroglobin, secretoglobin
Deposited on 2003-06-25, released 2003-10-14
The last revision prior to the SCOP 1.73 freeze date was dated 2003-10-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.203
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Major allergen I polypeptide, fused chain 2, chain 1
    Species: Felis silvestris catus
    Gene: CH2, CH1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1puoa1, d1puoa2
  • Chain 'B':
    Compound: Major allergen I polypeptide, fused chain 2, chain 1
    Species: Felis silvestris catus
    Gene: CH2, CH1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1puob1, d1puob2
  • Heterogens: MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1puoA (A:)
    vkmaetcpifydvffavangnellldlsltkvnatepertamkkiqdcyvenglisrvld
    glvmttissskdcmgeavqntvedlklntlgreicpavkrdvdlfltgtpdeyveqvaqy
    kalpvvlenarilkncvdakmteedkenalslldkiytsplclehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1puoA (A:)
    etcpifydvffavangnellldlsltkvnatepertamkkiqdcyvenglisrvldglvm
    ttissskdceicpavkrdvdlfltgtpdeyveqvaqykalpvvlenarilkncvdakmte
    edkenalslldkiytsplcle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1puoB (B:)
    vkmaetcpifydvffavangnellldlsltkvnatepertamkkiqdcyvenglisrvld
    glvmttissskdcmgeavqntvedlklntlgreicpavkrdvdlfltgtpdeyveqvaqy
    kalpvvlenarilkncvdakmteedkenalslldkiytsplclehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1puoB (B:)
    etcpifydvffavangnellldlsltkvnatepertamkkiqdcyvenglisrvldglvm
    ttissskdcmeicpavkrdvdlfltgtpdeyveqvaqykalpvvlenarilkncvdakmt
    eedkenalslldkiytsplcle