PDB entry 1pul

View 1pul on RCSB PDB site
Description: Solution structure for the 21KDa caenorhabditis elegans protein CE32E8.3. NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET WR33
Class: structural genomics, unknown function
Keywords: ALPHA HELICAL, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM, PSI, Protein Structure Initiative, NESG, structural genomics, unknown function
Deposited on 2003-06-25, released 2005-06-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein C32E8.3 in chromosome I
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: C32E8.3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pula1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pulA (A:)
    mghhhhhhshmaaaagfnwddadvkkrwdaftkfgaatatemtgknfdkwlkdagvldnk
    aitgtmtgiafskvtgpkkkatfdetkkvlafvaedrarqskkpiqdeldaiteklakle
    apsvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pulA (A:)
    nwddadvkkrwdaftkfgaatatemtgknfdkwlkdagvldnkaitgtmtgiafskvtgp
    kkkatfdetkkvlafvaedrarqskkpiqdeldaiteklakle