PDB entry 1puj

View 1puj on RCSB PDB site
Description: Structure of B. subtilis YlqF GTPase
Class: signaling protein
Keywords: STRUCTURAL GENOMICS, NYSGXRC T18, GTPASE, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, SIGNALING PROTEIN
Deposited on 2003-06-24, released 2003-07-08
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.216
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein ylqF
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YLQF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1puja_
  • Heterogens: MG, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pujA (A:)
    mtiqwfpghmakarrevteklklidivyelvdaripmssrnpmiedilknkprimllnka
    dkadaavtqqwkehfenqgirslsinsvngqglnqivpaskeilqekfdrmrakgvkpra
    iraliigipnvgkstlinrlakkniaktgdrpgittsqqwvkvgkelelldtpgilwpkf
    edelvglrlavtgaikdsiinlqdvavfglrfleehyperlkerygldeipediaelfda
    igekrgclmsgglinydktteviirdirtekfgrlsfeqptm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pujA (A:)
    hmakarrevteklklidivyelvdaripmssrnpmiedilknkprimllnkadkadaavt
    qqwkehfenqgirslsinsvngqglnqivpaskeilqekfdrmrakgvkprairaliigi
    pnvgkstlinrlakkniaqwvkvgkelelldtpgilwpkfedelvglrlavtgaikdsii
    nlqdvavfglrfleehyperlkerygldeipediaelfdaigekrgclmsgglinydktt
    eviirdirtekfgrlsfeqpt