PDB entry 1puj

View 1puj on RCSB PDB site
Description: structure of b. subtilis ylqf gtpase
Deposited on 2003-06-24, released 2003-07-08
The last revision prior to the SCOP 1.65 freeze date was dated 2003-07-08, with a file datestamp of 2003-07-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.216
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1puja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pujA (A:)
    mtiqwfpghmakarrevteklklidivyelvdaripmssrnpmiedilknkprimllnka
    dkadaavtqqwkehfenqgirslsinsvngqglnqivpaskeilqekfdrmrakgvkpra
    iraliigipnvgkstlinrlakkniaktgdrpgittsqqwvkvgkelelldtpgilwpkf
    edelvglrlavtgaikdsiinlqdvavfglrfleehyperlkerygldeipediaelfda
    igekrgclmsgglinydktteviirdirtekfgrlsfeqptm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pujA (A:)
    hmakarrevteklklidivyelvdaripmssrnpmiedilknkprimllnkadkadaavt
    qqwkehfenqgirslsinsvngqglnqivpaskeilqekfdrmrakgvkprairaliigi
    pnvgkstlinrlakkniaqwvkvgkelelldtpgilwpkfedelvglrlavtgaikdsii
    nlqdvavfglrfleehyperlkerygldeipediaelfdaigekrgclmsgglinydktt
    eviirdirtekfgrlsfeqpt