PDB entry 1puf

View 1puf on RCSB PDB site
Description: Crystal Structure of HoxA9 and Pbx1 homeodomains bound to DNA
Deposited on 2003-06-24, released 2003-09-02
The last revision prior to the SCOP 1.67 freeze date was dated 2003-09-02, with a file datestamp of 2003-09-02.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.233
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1pufa_
  • Chain 'B':
    Domains in SCOP 1.67: d1pufb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1pufA (A:)
nnpaanwlharstrkkrcpytkhqtlelekeflfnmyltrdrryevarllnlterqvkiw
fqnrrmkmkkinkdrak

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1pufB (B:)
arrkrrnfnkqateilneyfyshlsnpypseeakeelakkcgitvsqvsnwfgnkriryk
knigkfqeeaniy