PDB entry 1pub

View 1pub on RCSB PDB site
Description: GM2-activator Protein crystal structure
Deposited on 2003-06-24, released 2004-06-29
The last revision prior to the SCOP 1.71 freeze date was dated 2004-06-29, with a file datestamp of 2004-06-29.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: 0.209
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1puba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1pubA (A:)
ssfswdncdegkdpavirsltlepdpiivpgnvtlsvmgstsvplssplkvdlvlekeva
glwikipctdyigsctfehfcdvldmliptgepcpeplrtyglpchcpfkegtyslpkse
fvvpdlelpswlttgnyriesvlsssgkrlgcikiaaslkgi