PDB entry 1pua

View 1pua on RCSB PDB site
Description: Crystal Structure of Tetrahymena GCN5 with Bound Coenzyme A and a Phosphorylated, 19-residue Histone H3 peptide
Class: transferase/structural protein
Keywords: histone acetyltransferase, gcn5-related n-acetyltransferase, coa-binding protein, ternary complex, transferase/structural protein complex
Deposited on 2003-06-24, released 2003-09-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.232
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hat a1
    Species: Tetrahymena thermophila [TaxId:5911]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q27198 (Start-162)
      • see remark 999 (42)
      • see remark 999 (162)
    Domains in SCOPe 2.06: d1puaa_
  • Chain 'B':
    Compound: histone h3
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02303 (0-18)
      • modified residue (5)
  • Heterogens: COA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1puaA (A:)
lldfdiltndgthrnmkllidlknifsrqlpkmpkeyivklvfdrhhesmvilknkqkvi
ggicfrqykpqrfaevaflavtaneqvrgygtrlmnkfkdhmqkqnieylltyadnfaig
yfkkqgftkehrmpqekwkgyikdydggtlmecyihpyvdygr

    Sequence, based on observed residues (ATOM records): (download) 
    >1puaA (A:)
ldfdiltndgthrnmkllidlknifsrqlpkmpkeyivklvfdrhhesmvilknkqkvig
gicfrqykpqrfaevaflavtaneqvrgygtrlmnkfkdhmqkqnieylltyadnfaigy
fkkqgftkehrmpqekwkgyikdydggtlmecyihpyvdygr

  • Chain 'B':
    No sequence available.