PDB entry 1pu8

View 1pu8 on RCSB PDB site
Description: Crystal structure of H.pylori 3-methyladenine DNA glycosylase (MagIII) bound to 1,N6-ethenoadenine
Class: hydrolase
Keywords: Helix-hairpin-helix, 3-Methyladenine, BASE EXCISION REPAIR, GLYCOSYLASE, HYDROLASE
Deposited on 2003-06-24, released 2003-10-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.13 Å
R-factor: 0.204
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-methyladenine DNA glycosylase
    Species: Helicobacter pylori [TaxId:210]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O25323 (0-End)
      • see remark 999 (0)
      • see remark 999 (101)
      • see remark 999 (119)
      • see remark 999 (140)
      • modified residue (204)
    Domains in SCOPe 2.07: d1pu8a_
  • Chain 'B':
    Compound: 3-methyladenine DNA glycosylase
    Species: Helicobacter pylori [TaxId:210]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O25323
      • see remark 999 (101)
      • see remark 999 (119)
      • see remark 999 (140)
      • modified residue (204)
    Domains in SCOPe 2.07: d1pu8b_
  • Heterogens: EA1, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pu8A (A:)
    vldsfeilkalksldllknapawwwpnalkfeallgavltqntkfeavlkslenlknafi
    lenddeinlkkiayiefsklaecvrpsgfynqkakrlidlsgnilkdfqsfenfkqevtr
    ewlldqkgigkesadailcyacakevmvvdkysylflkklgieiedydelqhffekgvqe
    nlnsalalyentislaqlyarfhgkivefskqklelkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pu8A (A:)
    vldsfeilkalksldllknapawwwpnalkfeallgavltqntkfeavlkslenlknafi
    lenddeinlkkiayiefsklaecvrpsgfynqkakrlidlsgnilkdfqsfenfkqevtr
    ewlldqkgigkesadailcyacakevmvvdkysylflkklgieiedydelqhffekgvqe
    nlnsalalyentislaqlyarfhgkivefskqklel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pu8B (B:)
    vldsfeilkalksldllknapawwwpnalkfeallgavltqntkfeavlkslenlknafi
    lenddeinlkkiayiefsklaecvrpsgfynqkakrlidlsgnilkdfqsfenfkqevtr
    ewlldqkgigkesadailcyacakevmvvdkysylflkklgieiedydelqhffekgvqe
    nlnsalalyentislaqlyarfhgkivefskqklelkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pu8B (B:)
    ldsfeilkalksldllknapawwwpnalkfeallgavltqntkfeavlkslenlknafil
    enddeinlkkiayiefsklaecvrpsgfynqkakrlidlsgnilkdfqsfenfkqevtre
    wlldqkgigkesadailcyacakevmvvdkysylflkklgieiedydelqhffekgvqen
    lnsalalyentislaqlyarfhgkivefskqklel